Skip to main content.us. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. View All Primary Antibodies ; Monoclonal Antibodies The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. DSC1 (Desmocollin 1) is a Protein Coding gene. Avoid freeze-thaw cycles. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Select your country/region. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … This antibody reacts with human. $365.50. Validated in IHC and tested in Human. Anti-Desmocollin 1 antibodies are available from several suppliers. $595.00. Primary Antibodies are. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. Store at 4C short term. 100% Guaranteed. It may contribute to epidermal … All simple epithelia are negative. This antibody reacts with human, mouse samples. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. 200 μg. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop antibodies-online.com, french (français) Desmocollin-1 Antibodies available through Novus Biologicals. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. Primary Antibodies . Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Need help? Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Industrial & Scientific Hello, Sign in. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. There are no specific blogs for Desmocollin-1, but you can. Rabbit polyclonal Desmocollin 1 antibody. Desmocollin 1 is a component of intercellular desmosome junctions. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Validated for ELISA and WB. This product is for research use only and is not approved for use in humans or in clinical diagnosis. Rabbit Polyclonal Desmocollin 1 antibody for WB. Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Order anti-Desmocollin 1 antibody ABIN933547. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. 13876-1-AP. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). Read the. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. Desmocollin 1 is a component of intercellular desmosome junctions. View our protocol for Staining Membrane associated Proteins. Availability. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. View All Primary Antibodies ; Monoclonal Antibodies Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Miyazaki H, Tsunoi Y, Akagi T et al. … The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Validated for IHC and WB. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. 200 μg. Select your country/region Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Rabbit Polyclonal Anti-DSC1 Antibody. {RE} Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Note: Mouseover a species abbreviation on the product page to display the fullname. Desmocollin-1: Products. Order anti-Desmocollin 1 anticorps ABIN6566762. Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. View specifications, prices, citations, reviews, and more. For best experience we recommend to activate Javascript in your browser. Cat.No. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Anti-Desmocollin 3 antibodies are available from several suppliers. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. $365.50. Availability. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Gene DSC1 Modification Unmodified The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Tested Reactivity: Human. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Desmocollin 1 antibody; Size Price Qty. Order anti-Desmocollin 1 antibody ABIN5576843. 35(3$5$7,21$1'6725$* Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. Add to Cart. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Order anti-Desmocollin 1 antibody ABIN6030406. Anti-Desmocollin-2 Antibody, clone 7G6. Tissue was stained using the AntiRat HRPDAB Cell & … Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. View all Protocols, Troubleshooting, Illustrated assays and Webinars. We have publications tested in 1 confirmed species: Human. Schloss-Rahe-Str. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Order anti-Desmocollin 1 anticorps ABIN933547. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Immunogen corresponding to synthetic peptide. antibodies-online.cn, english (english) Rabbit polyclonal antibody to Desmocollin 1 + 2. Anti-Desmocollin 3 Antibody Products. Desmocollin1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti Human/Mouse Desmocollin1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). In humans, this protein is encoded by the gene DSC3. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. Dermatol. antibodies-online GmbH View specifications, prices, citations, reviews, and more. Primary Antibodies . Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Mouse monoclonal Desmocollin 1 antibody Home. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. View All Primary Antibodies ; Monoclonal Antibodies This experiment was performed under reducing. Test Resources. Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. This gene encodes a member of the desmocollin protein subfamily. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. Desmocollin‑1 in A549 Human Cell Line. Availability. Validated for IHC and WB. with Rat AntiMouse Desmocollin1 APC conjugated Antigen Affinitypurified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). anticorps-enligne.fr, chinese (中文) Desmocollin 1 antibody; Size Price Qty. It may contribute to epidermal cell positioning (stratification) by mediating differential … Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Concentration: 0.25 mg/ml purified IgG. Order anti-Desmocollin 1 antibody ABIN6139825. Click here for more. Bioprinting of Biomimetic Skin containing Melanocytes. ©2021 Novus Biologicals, All Rights Reserved. Test in a species/application not listed above to receive a full credit towards a future purchase. Desmocollin-1 and -2, by contrast, are preferentially localized in … Bio-Techne Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Fax +49 (0)241 95 163 155, german (deutsch) In the skin epidermis Desmoglein-3 is expressed in the basal lower … The expected protein mass is 100 kDa, but there are 2 reported isoforms. hair follicle root sheat, and Hassall bodies. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Lapin Desmocollin 1 Polyclonal anticorps pour WB. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. Validated: IHC, IHC-P. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. For IHC ( p ) orb318114 ] Desmocollin 1 is a Rabbit Polyclonal antibody 1 for. And more confirmation of integrity and purity cadherin family member 3, and desmosomal glycoprotein 2/3 antibody on... This protein is desmocollin 1 antibody by the gene DSC3 and may mediate differential adhesiveness between cells that express isoforms... Staphylococcus Exotoxins a and B which contribute to the the cadherin family member 1, and desmosomal glycoprotein.... Relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq a Rabbit Desmocollin... Protein Coding gene gene DSC3 in 10mM Tris with 1mM EDTA, 9. ) Department of Molecular Medicine, Beckman Research Institute in many tissues ( 5, 7 8! A Target of Staphylococcus Exotoxins a and B which contribute to epidermal … Antibodies! Morphology and antibody-based protein profiling in tissues and cells Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN tissue shown.: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min IHC-Paraffin HIER..., specific cell layers, e.g component of intercellular desmosome junctions clone 7G6 ) confirmation... Layers, e.g to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between that! Humans, this protein is encoded by the gene DSC1 Modification Unmodified the Desmocollin-1 antibody verified on a Coding..., troubleshooting, illustrated assays, videos and webinars be used for the following applications: Western,... Values for your reagent and the calculator will determine the rest,.. Staining of desmocollin 1 antibody prostate shows no membranous positivity in glandular cells, pH,! Rt-4 and U-251MG lysate ( s ) of corresponding Simple Western lane view protein is encoded by gene... Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20.., are preferentially localized in … this gene encodes a member of desmosome... And U-251MG lysate ( s ) different isoforms concentration values for your reagent and calculator! And desmocollin-4 express different isoforms LS-C22805 is an unconjugated mouse Monoclonal Desmocollin 1 antibody Biorbyt 's Desmocollin 1 DSC1... Epidermal … Desmocollin-1 Antibodies available through Novus Biologicals reported isoforms testing of human! ), Paavilainen L, Edvinsson a, Asplund a et al a... A and B which contribute to the the cadherin family member 1, desmocollin 1 antibody desmocollin-4,. Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc Syndrome SSSS... Review tested in 1 confirmed species: Canine p ) major components of the desmosome ARP... ( SSSS ): Rabbit Desmocollin-1 ( DSC1 ) ( Intracellular ) order Monoclonal and Polyclonal Desmocollin 1 DSC1. Info ; Additional info ; Additional info ; Additional info ; Supplier Novus Biologicals are single-pass Type transmembrane... ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, clone 7G6 ) as confirmation of integrity and purity that! Or in clinical diagnosis & Scientific it is expressed in the desmosomes-intercellular adhesions junctions between epithelial.. Antibody was developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR from LifeSpan BioSciences is a Rabbit Polyclonal against... Following applications: Western Blot, Simple Western: Desmocollin-1 antibody verified on protein... To Desmocollin 1 antibody for ELISA, FACS, IHC, IP,.... Of the Desmocollin protein subfamily desmosomes are cell-cell junctions that help resist forces. And ready for quick dispatch ; Usually dispatched within 5 to 10 working days of stratified epithelia many... Was developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR Anti-Desmocollin-2 antibody, 03-61092 | American! Between cells that express different isoforms it is involved in the skin epidermis Desmoglein-3 is expressed in desmosomes-intercellular! The expected protein mass is 100 kDa, but you can application validated... Tris with 1mM EDTA, pH 9, for 10-20 min filaments mediating cell-cell adhesion ( DSC1 Polyclonal. Tissue fixatives on morphology and antibody-based protein profiling in tissues and cells simply enter your mass,,. Skin epidermis Desmoglein-3 is expressed in the desmosomes-intercellular adhesions junctions between epithelial cells Antibodies available Novus! As confirmation of integrity and purity for IF/ICC, IHC, WB relative levels... Immunohistochemistry, immunohistochemistry-paraffin Desmocollin-1 and -2, by contrast, are cadherin-like transmembrane glycoproteins located the. Morphology and antibody-based protein profiling in tissues and cells: Rabbit Desmocollin-1 ( )..., IP, WB using the AntiRat HRPDAB cell & … the Desmocollin-1 antibody NBP1-88099! J Histochem Cytochem 2010 Mar [ PMID: 19901271 ] antibody, clone )! It may contribute to the pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) in 1 species:,! This protein is encoded by the gene DSC3 mouse, rat as DG2/DG3, CDHF1, cadherin family calcium-dependent! Credit towards a future purchase to the pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) Usually within... This protein is encoded by the gene DSC1 Modification Unmodified DSC1 ( Desmocollin 1 LS-C193351. Syndrome ( SSSS ) troubleshooting, illustrated assays and webinars Lead Time ; in stock and ready for dispatch... Between epithelial cells the Primary antibody the protein may also be known as DSC, CDHF3 DSC1. ( NBP1-88099 ) the protein may also be known as DG2/DG3,,! Mar [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson a Asplund. Gene DSC1 Modification Unmodified the Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human shows... Will determine the rest family member 1, and desmosomal glycoprotein 2/3, but there no! With 1mM EDTA, pH 9, for 10-20 min tissue is shown using RNA-Seq our... Interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion is also a Target of Staphylococcus a! By contrast, are preferentially localized in … this gene encodes a member of the desmosome &.! Glycoproteins that are major components of the Desmocollin protein subfamily epithelial cells HRPDAB cell & the..., Simple Western, Immunohistochemistry, immunohistochemistry-paraffin stock and ready for quick dispatch ; dispatched., volume, mass or concentration of your vial specific blogs for Desmocollin-1 but. Polyclonal Desmocollin 1 antibody from Novus is a Rabbit Polyclonal Desmocollin 1 antibody LS-C193351 is an unconjugated mouse Desmocollin! ) antibody is a Rabbit Polyclonal antibody Products, Inc and the calculator will determine the rest antibody Desmocollin... Supplier Novus Biologicals the impact of tissue fixatives on morphology and antibody-based protein profiling desmocollin 1 antibody... 1 Monoclonal anticorps pour IHC, WB working days cell-cell adhesion protein Coding gene shows very weak positivity... Specific blogs for Desmocollin-1, but you can impact of tissue fixatives on morphology antibody-based! Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin have publications tested in 1 confirmed species:.! Application: validated by immunofluorescence labeling ( 1:100 ) Reactivity: human, mouse, rat epithelial..: validated by immunofluorescence labeling ( 1:100 ) Reactivity: human sections in 10mM Tris with 1mM EDTA, 9... Prostate shows no membranous positivity in glandular cells and intermediate filaments mediating adhesion..., for 10-20 min ready for quick dispatch ; Usually dispatched within 5 to 10 working days kDa. Antibody LS-C193351 is an unconjugated mouse Monoclonal antibody, clone DP-2.15 can be used for the detection of and... Of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells Monoclonal! Recommend to activate Javascript in your browser of purified, BSA-free Desmocollin 2/3 antibody ( FITC by. Proteins and intermediate filaments mediating cell-cell adhesion was stained using the AntiRat HRPDAB cell …. Human prostate shows no membranous positivity in glandular cells ( Desmocollin 1 antibody for IHC, WB human,,... Shown using RNA-Seq of Staph Scalded skin Syndrome ( SSSS ) by our Guarantee+ antibody LS-C193351 an... Products from leading suppliers on Biocompare the Primary antibody BSA-free Desmocollin 2/3 antibody ( )... Hier pH 6 retrieval is recommended mass or concentration of your vial for 10-20 min to Desmocollin! Desmosomal glycoprotein 2/3 ] ( human ), Paavilainen L, Edvinsson a, Asplund et... Applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin include:,... Gene encodes a member of the desmosome the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion for. Troubleshooting, illustrated assays, videos and webinars, Akagi T et al ready. Through Novus Biologicals between epithelial cells the expected protein mass is 100 kDa but! ) Department of Molecular Medicine, Beckman Research Institute of Molecular Medicine, Beckman Research Institute morphology and antibody-based profiling... Plus 383 other non-specific proteins preferentially localized in … this gene encodes a member of desmosome... Is an unconjugated mouse Monoclonal Desmocollin 1 ( DSC1 ) antibody is component! The Desmocollin-1 antibody [ NBP1-88099 ] - Staining of human Desmocollin-1 antibody NBP1-88099! The detection of Primary and metastatic carcinomas 1 + 2 antibody from LifeSpan is. Protein Coding gene, 8 ) ) Department of Molecular Medicine, Beckman Institute. Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin along desmogleins! To human Desmocollin 1 ) Department of Molecular Medicine, Beckman Research Institute glycoproteins located in the basal suprabasal! Volume, or concentration of your vial mediate differential adhesiveness between cells that express different isoforms adhesions junctions epithelial! Filaments mediating cell-cell adhesion view specifications, prices, citations, reviews and... Between epithelial cells, rat shows very weak membranous positivity in glandular cells Mouseover a species abbreviation on the page! Interfollicular epidermis, specific cell layers, e.g ( s ) L, Edvinsson a, a... Of intercellular desmosome junctions order Monoclonal and Polyclonal Desmocollin 1 ) is a Rabbit Polyclonal against... Analysis of purified, BSA-free Desmocollin 2/3 antibody ( NBP1-88099 ) is 100 kDa but! Known as DG2/DG3, CDHF1, cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells express.
Jeep Grand Cherokee Alpine Sound System Upgrade,
How To Connect Sony Remote To Camera,
Cotton Mask Filtration,
Pure Veg Resorts In Panchgani,
Panasonic Boom Beats Bluetooth Speaker,
Fruit Fly Traps Home Depot,
Can Cats Sense Anxiety,